Neural nets based on profile of psiBLAST comparison of the query sequence with NR database.
Output example:
>T0388 Length=174 PredSS bbbbb aa bbbbbbbb aaa AA seq ENLYFQSMINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRN ProbA 00242002220000000000000000552110000000000110000766 ProbB 00002200000334888851103452000100499999985010000000 PredSS aaaaaaaaaaaa bbbbbbb aaaaaaaaaa bbb AA seq YLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFP ProbA 77999999998520000000000121301000089899999971100000 ProbB 00000000000000389999873100000000000000000000104879 PredSS bb aaaaaaaa bbbbb bbbbbb AA seq IFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEE ProbA 00100000010115888787643000000000000000000000000000 ProbB 86453442200000000000000000133438988920008999983000 PredSS aaaaaaaaaaaaaaaaaa AA seq PIEVIRPDIAALVRQVIIKKKEDL ProbA 055688999999999997743000 ProbB 000000000000000000000000
Where:
PredSS - secondary structure predicted:
a - alpha helix, b - beta sheet;
AA seq - amino acid sequence in one-letter form;
ProbA - probability of 'a' structure for the position,
ProbB - probability of 'b' structure for the position.
>T0388 Length=174 1 E C 0 0 2 N C 0 0 3 L C 2 0 4 Y C 4 0 5 F C 2 2 6 Q C 0 2 7 S C 0 0 8 M C 2 0 9 I C 2 0 10 N C 2 0 11 S C 0 0 12 F C 0 3 13 Y C 0 3 14 A C 0 4 15 F B 0 8 16 E B 0 8 17 V B 0 8 18 K B 0 8 19 D B 0 5 20 A C 0 1 21 K C 0 1 22 G C 0 0 23 R C 0 3 24 T C 0 4 25 V C 0 5 26 S C 0 2 27 L A 5 0 28 E A 5 0 29 K C 2 0 30 Y C 1 1 31 K C 1 0 32 G C 0 0 33 K C 0 4 34 V B 0 9 35 S B 0 9 36 L B 0 9 37 V B 0 9 38 V B 0 9 39 N B 0 9 40 V B 0 8 41 A B 0 5 42 S C 1 0 43 D C 1 1 44 C C 0 0 45 Q C 0 0 46 L C 0 0 47 T C 0 0 48 D A 7 0 49 R A 6 0 50 N A 6 0 51 Y A 7 0 52 L A 7 0 53 G A 9 0 54 L A 9 0 55 K A 9 0 56 E A 9 0 57 L A 9 0 58 H A 9 0 59 K A 9 0 60 E A 9 0 61 F A 8 0 62 G A 5 0 63 P C 2 0 64 S C 0 0 65 H C 0 3 …
Where:
1 column - a number of position,
2 column - amino acid sequence in one-letter form,
3 column - secondary structure predicted: A - alpha helix, B - beta sheet;
4 column - probability of 'A' structure for the position,
5 column - probability of 'B' structure for the position.